DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG33465

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:301 Identity:71/301 - (23%)
Similarity:121/301 - (40%) Gaps:81/301 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RSLMLVLLAAISVVG-------QPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLL 64
            |.|.|.|:..:...|       :..||..|..|..::.....:       ||...:.::  :..:
  Fly     3 RVLSLALIGLVLCQGLAQLLDKKCHDPKTSENINFNHGATETA-------PWMASIYKN--NQFI 58

  Fly    65 CGGSIISDTWVLTAAHCTNGLSSIFLMFGTVD-------LFN------ANAL---NMTSNNIIIH 113
            |.|:::...:|||||.|.:..|.::::||..:       .||      |.||   |...||.:  
  Fly    59 CDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGV-- 121

  Fly   114 PDYNDKLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVA---TIAGFGYTE---DEYL 172
                    ||:.|::|...:|..|:|:.|.::      :|:|...|   ...|||:.:   :...
  Fly   122 --------NDIGLLRLYGEVTHYAHIRPICII------LDHVVKSAPFERFEGFGWQQQGTEASS 172

  Fly   173 DYSETLLYAQ---VEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLI------L 228
            ...:|:..:|   .|...|...:.|.      :...||   ...|.|.|..:||.||.      :
  Fly   173 QVRQTVYLSQKKPFECHRNGQLLPIN------EGQFCA---GNRDRSFCRSNSGSPLTADFTYGV 228

  Fly   229 YNKTIQQWQQIGINSFVAEDQCTYRLP-SGYARVSSFLGFI 268
            .|.|:    |:|:.|:.:| .|:   | |.|..|.:|..:|
  Fly   229 KNITV----QVGLVSYGSE-LCS---PTSVYTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 61/262 (23%)
Tryp_SPc 38..271 CDD:238113 62/263 (24%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 62/251 (25%)
Tryp_SPc 46..261 CDD:214473 61/249 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436508
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.