DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and sphinx2

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:283 Identity:67/283 - (23%)
Similarity:114/283 - (40%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLAAISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVI------LKRDAWDDLLCG-GSII 70
            |:.|:.|:...|.....:  |:..||..|..||    |:.:|      ..:.....|..| |:||
  Fly     3 LVVALLVLSLTFSVCEKN--KLSPRITGGYRAK----PYTIIYLVGIVYAKSPLSSLKFGAGTII 61

  Fly    71 SDTWVLTA----------AHCTNGLSSIFLMFGTVDLF-NANALNMTSNNIIIHPDYNDKLNNDV 124
            |:.|:||.          ||           ||:...| ..:.|.:...|...|.|    ....:
  Fly    62 SNQWILTVKEVLIFKYIEAH-----------FGSKRAFWGYDILRIYRENFYFHYD----KTRII 111

  Fly   125 SLIQLPEPLTFSANIQAIQLVGQYGDSID-YVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDN 188
            :|::.|.. .|...:..:: |..||...: |||::..:.|:| |:...:.....:...:||:::|
  Fly   112 ALVKCPYQ-KFDRRMSRVR-VPAYGARFERYVGNMTMVCGWG-TDKRKVRLPTWMRCVEVEVMNN 173

  Fly   189 ADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILY--NKTIQQWQQIGINSFVAEDQCT 251
            .:|...:......:.....:||.|    .|.||.||.::..  |.|.     ||| .::....|:
  Fly   174 TECAKYHTPLKWYEMCTSGEGFKG----VCEGDMGGAVVTMGPNPTF-----IGI-IWLMPTNCS 228

  Fly   252 YRLPSGYARVSSFLGFIADKTGI 274
            ...||.:.|||..:.:|...:|:
  Fly   229 IGYPSVHIRVSDHIKWIKHVSGV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 60/251 (24%)
Tryp_SPc 38..271 CDD:238113 60/253 (24%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 60/251 (24%)
Tryp_SPc 26..248 CDD:304450 60/253 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.