DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and yip7

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:279 Identity:96/279 - (34%)
Similarity:136/279 - (48%) Gaps:26/279 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LMLVLLAAISVVG-----QPFDPAN--SSPIKIDNRIVSGSDAKLGQFPWQVIL----KRDAWDD 62
            ::|||..|.:..|     .|..|.:  |:| .|..||.:|.||..||||:||.|    ...:|  
  Fly     5 VVLVLALASASAGLLPNIAPVHPRDRVSTP-SITGRITNGKDAVAGQFPYQVGLSFSSSAGSW-- 66

  Fly    63 LLCGGSIISDTWVLTAAHCTNGLSSIFLMFG-TVDLFNANALNMTSNNIIIHPDYND-KLNNDVS 125
             .||||||.:.|||||||||:|.:|:.:.:| ||.........::|:....|..|.. .:.||:|
  Fly    67 -WCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDIS 130

  Fly   126 LIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNAD 190
            ||| ...::|||.:..|.|.........|.|..|..:|:|.|.|:....|..|.|..:.||.|:.
  Fly   131 LIQ-TSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSK 194

  Fly   191 CVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLP 255
            |...:|..:|....:|..  ..:..|||.|||||||.|      ....||..||.:.|.|....|
  Fly   195 CQETFGSLIVTSRVLCVD--TTNKASTCQGDSGGPLAL------DGVLIGATSFGSADGCESGAP 251

  Fly   256 SGYARVSSFLGFIADKTGI 274
            :.:.|::.:..:|.:.:||
  Fly   252 AAFTRITYYRDWIKETSGI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 83/236 (35%)
Tryp_SPc 38..271 CDD:238113 83/238 (35%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 83/236 (35%)
Tryp_SPc 40..267 CDD:238113 83/238 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471034
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm50958
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.