DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and KLKB1

DIOPT Version :10

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:255 Identity:76/255 - (29%)
Similarity:128/255 - (50%) Gaps:30/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIDNRIVSGSDAKLGQFPWQVILK-RDAWDDLLCGGSIISDTWVLTAAHCTNG--LSSIFLMFGT 94
            |...|||.|:::..|::||||.|: :......|||||:|...||||||||.:|  |..::.::..
Human   397 KTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSG 461

  Fly    95 VDLFNANALNMTS----------NNIIIHPDYN-DKLNNDVSLIQLPEPLTFSANIQAIQLVGQY 148
            :       ||::.          ..||||.:|. .:.|:|::||:|..||.::...:.|.|..:.
Human   462 I-------LNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKG 519

  Fly   149 GDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGS 213
            ..|..|..  ..:.|:|:::::. :....|....:.::.|.:|...|..|.:....:|| |:...
Human   520 DTSTIYTN--CWVTGWGFSKEKG-EIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCA-GYKEG 580

  Fly   214 DMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYR-LPSGYARVSSFLGFIADKT 272
            ....|.|||||||:.  |....|:.:||.|:  .:.|..| .|..|.:|:.::.:|.:||
Human   581 GKDACKGDSGGPLVC--KHNGMWRLVGITSW--GEGCARREQPGVYTKVAEYMDWILEKT 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 72/245 (29%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 402..632 CDD:238113 71/244 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.