DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG15873

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:181 Identity:46/181 - (25%)
Similarity:85/181 - (46%) Gaps:17/181 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RDAWDDLLCGGSIISDTWVLTAAHC----------TNGLSSIFLMFGTVDLFNANALNMTSNNII 111
            |...|:..|.|.::|...|||||||          ..|:..:|.....:.:::.:... :.:.::
  Fly    61 RHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFR-SVDRLV 124

  Fly   112 IHPDYNDKLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSE 176
            :||:|.....||:::::|.|.:. |:|...:.|:.:...::.| |......|:|... ::..||.
  Fly   125 VHPEYERYKKNDLAILRLSERVQ-SSNHDVLPLLMRKTANVTY-GDTCITLGWGQIY-QHGPYSN 186

  Fly   177 TLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLI 227
            .|:|..|.:...:.|...|..: ..|..:|.:.. |..|: |.||.||||:
  Fly   187 ELVYLDVILRPPSLCQKHYDTF-TADHNVCTEPV-GESMN-CAGDMGGPLL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 46/181 (25%)
Tryp_SPc 38..271 CDD:238113 46/181 (25%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 46/181 (25%)
Tryp_SPc 59..250 CDD:238113 46/181 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.