DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG10764

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:123/277 - (44%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLMLVLLAAISVVGQPFDPANSSPIKIDNR--IVSGSDAKLGQFPWQVILKRDAWDDLLCGGSII 70
            |:.|:.|..:.|..........:|..|..|  |..|.||......|...:...:  |..|||:||
  Fly     6 SVALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSS--DFQCGGTII 68

  Fly    71 SDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALNMTSNNIIIHPDY-NDKLNNDVSLIQLPEPLT 134
            ...:||:||||......:::..|..:: |..|...|..|:.:|.|: ..:..||:.|:||.|.:.
  Fly    69 HMRFVLSAAHCLVRGYDLYVRLGARNI-NEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSESIV 132

  Fly   135 FSANIQAIQLVGQYGDSID--YVGSVATI-----AGFGYTEDEYLDYSETLLYAQVEIIDNADCV 192
            ::..:|.|.:.      :|  ..|||..:     .|:|....:.....:|:....::   ..:|.
  Fly   133 YTVRVQPICIF------LDPALKGSVEKLKTFRALGWGNRNGKLSIMLQTIYLLHLK---RNECK 188

  Fly   193 AIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPL---ILY--NKTIQQWQQIGINSFVAEDQCTY 252
            ... .:.:....:||...:|   .||.|||||||   ||:  ||:.:  .|:||.|| .:.:|  
  Fly   189 RKL-NFNLNSRQICAGTKNG---DTCRGDSGGPLSTNILFPSNKSYE--VQLGIVSF-GDPEC-- 244

  Fly   253 RLPSGYARVSSFLGFIA 269
            |....|..|:|::.:|:
  Fly   245 RGVGVYTDVTSYVDWIS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 67/245 (27%)
Tryp_SPc 38..271 CDD:238113 67/245 (27%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 66/243 (27%)
Tryp_SPc 38..263 CDD:238113 67/245 (27%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.