DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and Ctrc

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:290 Identity:91/290 - (31%)
Similarity:133/290 - (45%) Gaps:55/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLMLVLLAAISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQV---ILKRDAWDDLLCGGSI 69
            :::..:||..|..|.|..|.|     :..|:|.|.||....:||||   .||.|.|.. .||||:
  Rat     5 TVLAAILACASCCGNPAFPPN-----LSTRVVGGEDAVPNSWPWQVSLQYLKDDTWRH-TCGGSL 63

  Fly    70 ISDTWVLTAAHCTN-------GLSSIFL--------MFGTVDLFNANALNMTSNNIIIHPDYNDK 119
            |:.:.|||||||.|       ||....|        ::..||            .|.:|..:|..
  Rat    64 ITTSHVLTAAHCINKDFTYRVGLGKYNLTVEDEEGSVYAEVD------------TIYVHEKWNRL 116

  Fly   120 -LNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSI--DYVGSVATIAGFG--YTEDEYLDYSETLL 179
             |.||:::|:|.||:..|..|| :..:.:.|..:  ||   ...:.|:|  :|..   ..:|.|.
  Rat   117 FLWNDIAIIKLAEPVELSNTIQ-VACIPEEGSLLPQDY---PCYVTGWGRLWTNG---PIAEVLQ 174

  Fly   180 YAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQ--QWQQIGIN 242
            .....|:.:|.|..:...::.|..||...|.||. :|.|.|||||||   |...:  .||..||.
  Rat   175 QGLQPIVSHATCSRLDWWFIKVRKTMVCAGGDGV-ISACNGDSGGPL---NCQAEDGSWQVHGIV 235

  Fly   243 SFVAEDQC-TYRLPSGYARVSSFLGFIADK 271
            ||.:...| .::.|..:.|||::..:|.:|
  Rat   236 SFGSSSGCNVHKKPVVFTRVSAYNDWINEK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 82/256 (32%)
Tryp_SPc 38..271 CDD:238113 82/258 (32%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 82/256 (32%)
Tryp_SPc 30..265 CDD:238113 82/258 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.