DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG12133

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:294 Identity:75/294 - (25%)
Similarity:118/294 - (40%) Gaps:95/294 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IVSGSDAKLGQFPWQVILKRDAW-----DDLLCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDL 97
            ||.|.:|:..||||.|:|..:|:     ...:|.||:|:..:|||||||.|           |:.
  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLN-----------VND 115

  Fly    98 FNANALNMTSNNIIIHPDY-------------------------------NDKLNNDVSLIQLPE 131
            |....:.:..::....|||                               |.:..||::|::|..
  Fly   116 FYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKS 180

  Fly   132 PLTFSANIQAI------------------QLVGQYGDS-IDYVGSV---ATIAGFGYTEDEYLDY 174
            .:.::..|:.|                  |:.| :||| :....:|   .||:|.  :.||.|:.
  Fly   181 RVKYTLQIRPICIWPGIELSTSSFKNFPFQIAG-WGDSGLQQKSTVLRQGTISGM--SPDECLNR 242

  Fly   175 SETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLIL-YNKTIQQWQQ 238
            ..|||      :|.             |..:||.|:||:|  |..||||.||:. ..:...|:..
  Fly   243 YPTLL------VDK-------------DIQICAMGWDGTD--TGLGDSGSPLMASVGRGADQFYY 286

  Fly   239 I-GINSFVAEDQCTYRLPSGYARVSSFLGFIADK 271
            : ||.|:..........|:.|.:.||:..:|..|
  Fly   287 LAGITSYGGGPSSYGYGPAVYTKTSSYYEWIKKK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 73/289 (25%)
Tryp_SPc 38..271 CDD:238113 74/292 (25%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 74/292 (25%)
Tryp_SPc 62..317 CDD:214473 73/289 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.