DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and try-9

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:229 Identity:47/229 - (20%)
Similarity:81/229 - (35%) Gaps:78/229 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GSIISDTWVLTAAH-----------C-TNGLSSI--------FLMFGTV--------------DL 97
            |:::|...::||||           | |..|...        |:.|..|              |:
 Worm    30 GTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLHRKDM 94

  Fly    98 FNANALNMTSNNIIIHPDY------NDKLNNDVSLIQLPEPLTFSANI--------QAIQLVGQY 148
            |...|:    .::.|...|      :.:..||:::.:|.||:.||.:|        ..|..:.:.
 Worm    95 FKPLAI----KSLYIRKGYVGDGCIDRESFNDIAVFELEEPIEFSKDIFPACLPSAPKIPRIRET 155

  Fly   149 GDSIDYVGSVATIAGFGYTEDEYLDYSET----LLYAQVEIIDNADCVAIYGKYVVVDSTMCAKG 209
            |..:           |||..|......|:    .||:.|     |:|...:....|..::...:|
 Worm   156 GYKL-----------FGYGRDPSDSVLESGKLKSLYSFV-----AECSDDFPYGGVYCTSAVNRG 204

  Fly   210 FDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINS 243
            .      :|.||||..::..:.|......:|:.|
 Worm   205 L------SCDGDSGSGVVRTSDTRNVQVLVGVLS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 47/229 (21%)
Tryp_SPc 38..271 CDD:238113 47/229 (21%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 47/229 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.