DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and scaf

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:238 Identity:65/238 - (27%)
Similarity:111/238 - (46%) Gaps:43/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNGL--SSIFLMFGTVDLFNAN 101
            |...||...:.|||.::.|::...|:|||:||.|.:||::|.|.|||  :.|.:..|..:|.:.|
  Fly   424 VKDLDANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTN 488

  Fly   102 ---ALNMTS-NNIIIHPDYNDKLN-NDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATI 161
               ...:|. ..:.:||||:...| :|:::|:|...|.|:::||.|.:..:  |..|  ......
  Fly   489 EPLPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDE--DPKD--SEQCFT 549

  Fly   162 AGFG------YTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFD-GSDMSTCT 219
            :|:|      :.|...:..::||..|:.|...::..|....|:   ||..    || ||.::..:
  Fly   550 SGWGKQALSIHEEGALMHVTDTLPQARSECSADSSSVCSATKF---DSCQ----FDVGSALACGS 607

  Fly   220 GDS--------------GGPLILYNKTIQQWQQIGINSFVAED 248
            |.|              .|..:.:.|...:|    ||:..||:
  Fly   608 GSSVRLKGIFAGENSCGEGQTVRFAKPDIKW----INTAFAEN 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 65/238 (27%)
Tryp_SPc 38..271 CDD:238113 65/238 (27%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 57/198 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.