DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and Prss21

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:289 Identity:90/289 - (31%)
Similarity:135/289 - (46%) Gaps:73/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MLVLLAAISVVGQ-------PFDP-------AN--SSPI---KIDNRIVSGSDAKLGQFPWQVIL 55
            :||::.|:.|..|       |.||       ||  |.|.   .|.:|||.|.:|:||::|||..|
  Rat    11 LLVVVVAVEVTLQSTSSHVKPVDPEKPELQEANLLSGPCGHRTIPSRIVGGEEAELGRWPWQGSL 75

  Fly    56 KRDAWDDLLCGGSIISDTWVLTAAHCTNGLSSIF---LMFGTV----DLFNANALNMTSN----- 108
            :  .|.:.|||.::::..||||||||....:..|   :.||.:    .|:|..|.   ||     
  Rat    76 R--VWGNHLCGATLLNRRWVLTAAHCFQKDNDPFDWTVQFGELTSRPSLWNLQAY---SNRYQIE 135

  Fly   109 NIIIHPDYNDKLNNDVSLIQLPEPLTFSANIQAIQLVG---QYGDSIDYVGSVATIAGFG-YTED 169
            :|.:.|.|.::..:|::|::|..|:|:|..||.|.|:.   ::.:..|     ..:.|:| ..||
  Rat   136 DIFLSPKYTEQFPHDIALLKLSSPVTYSNFIQPICLLNSTYKFANRTD-----CWVTGWGAIGED 195

  Fly   170 EYLDYSETLLYAQVEIIDNADC----------VAIYGKYVVVDSTMCAKGFDGSDMSTC------ 218
            |.|.....|...||.||:|..|          :.|:|..|      ||...:|. ...|      
  Rat   196 ESLPLPNNLQEVQVAIINNTMCNHLFKKPDFRINIWGDMV------CAGSPEGG-KDACFAKLTY 253

  Fly   219 ---TGDSGGPLILYNKTIQQWQQIGINSF 244
               .|||||||:....|:  |.|:|:.|:
  Rat   254 AAPQGDSGGPLVCNQDTV--WYQVGVVSW 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 77/243 (32%)
Tryp_SPc 38..271 CDD:238113 76/242 (31%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 77/243 (32%)
Tryp_SPc 58..304 CDD:238113 76/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.