DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG9377

DIOPT Version :10

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:243 Identity:55/243 - (22%)
Similarity:94/243 - (38%) Gaps:59/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNG--LSSIFLMFG----TVDLFNAN 101
            :||.|:|||.|.:...  |..||.|::|:...|:|.|||...  :..:.|:.|    .|:|....
  Fly   106 EAKFGEFPWLVAVYGS--DTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQP 168

  Fly   102 ALNMTSNNIIIHPDYND---KLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAG 163
            ....:....::||:|..   ..|..:.|:...:|...:.|:|.|.|.   ...|.|..|...::|
  Fly   169 HQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLP---PPRIMYNYSQCYVSG 230

  Fly   164 FGYTEDEYLDYSETLLYAQ---VEIIDNADC-----VAIYG-KYVVVDSTMCAKGFDGS------ 213
            :     :..|:....:..:   :.::....|     :::.| ::...||.:||.|..|.      
  Fly   231 W-----QRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVCGDV 290

  Fly   214 DMS---------------------TCTGDSGGPLIL--YN--KTIQQW 236
            ||:                     |.|....||.:|  |.  |..:||
  Fly   291 DMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQW 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 55/243 (23%)
CG9377NP_609640.1 PRK06406 <19..>80 CDD:235796
Tryp_SPc 105..339 CDD:214473 55/243 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.