DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and psh

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:271 Identity:77/271 - (28%)
Similarity:121/271 - (44%) Gaps:34/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PANSSPIKIDNR------------IVSGSDAKLGQFPWQVILKRDAW-DDLLCGGSIISDTWVLT 77
            ||.::..||..|            ||.|.....|.:|....:....: .|..||||:|:..:|||
  Fly   120 PAVAACKKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLT 184

  Fly    78 AAHC--TNGLSSIFLMFGTVDLFNA--NALNMTSNNIIIHPDYNDKLNNDVSLIQLPEPLTFSAN 138
            ||||  |:..:..|:..|.|::.|.  :..::...::.|||.|.....||:::::|...:..:.|
  Fly   185 AAHCVNTDANTPAFVRLGAVNIENPDHSYQDIVIRSVKIHPQYVGNKYNDIAILELERDVVETDN 249

  Fly   139 IQAIQLVGQYGDSID-YVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYG------ 196
            |:...|   :.|:.| ...|...:||:|.........|:.||.|.:|::....|...|.      
  Fly   250 IRPACL---HTDATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSI 311

  Fly   197 ---KYVVVDSTMCAKGFDGSDMS-TCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSG 257
               |..|:||.:||  .|...:: .|.|||||||| :...::......:....:...|....|..
  Fly   312 RLLKQGVIDSLLCA--IDQKLIADACKGDSGGPLI-HELNVEDGMYTIMGVISSGFGCATVTPGL 373

  Fly   258 YARVSSFLGFI 268
            |.||||:|.||
  Fly   374 YTRVSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 71/258 (28%)
Tryp_SPc 38..271 CDD:238113 72/247 (29%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 70/246 (28%)
Tryp_SPc 144..387 CDD:238113 72/247 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437065
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.