DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG31220

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:290 Identity:80/290 - (27%)
Similarity:132/290 - (45%) Gaps:64/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PANSSPIKID-------NRIVSGSDAKLGQFPWQVIL---KRDAWD---DLL--CGGSIISDTWV 75
            |||:.|...|       ||::.|::..|.::||..:|   .|.|::   :|:  ||||:|:..:|
  Fly    85 PANTLPSYPDCGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYV 149

  Fly    76 LTAAHCTNGLSSIFLMFGTV-----------DLFNANA--------LNMTSNNIIIHPDY---ND 118
            ||||||   ::...|....|           |..:..|        |::...:|..|.||   |.
  Fly   150 LTAAHC---VTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANY 211

  Fly   119 KLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVAT----IAGFGYTEDEYLDYSETLL 179
            ...||::|::|.||:.::.....|.:       :||..|:..    :||:|.| ..:...|:.|.
  Fly   212 TFRNDIALVRLKEPVRYTMAYYPICV-------LDYPRSLMKFKMYVAGWGKT-GMFDTGSKVLK 268

  Fly   180 YAQVEIIDNADCVAIYG-KYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQI---- 239
            :|.|::....:|...|. ::......:||.|.|  :..||.||||.||:  ..:.:.::.|    
  Fly   269 HAAVKVRKPEECSEKYAHRHFGPRFQICAGGLD--NRGTCDGDSGSPLM--GTSGRSYETITFLA 329

  Fly   240 GINSFVAEDQC-TYRLPSGYARVSSFLGFI 268
            ||.|:  ...| |...||.:.|.:.|..:|
  Fly   330 GITSY--GGPCGTIGWPSVFTRTAKFYKWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 73/270 (27%)
Tryp_SPc 38..271 CDD:238113 73/271 (27%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 73/270 (27%)
Tryp_SPc 104..360 CDD:238113 73/271 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.