DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and sphinx1

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:279 Identity:67/279 - (24%)
Similarity:116/279 - (41%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MLVLLAAISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQV--ILKRDAWDDLLCG-GSIIS 71
            :|||...:||         ....|:..||..|..||.....:.|  :..:.....|..| |:|||
  Fly     7 LLVLSLTVSV---------GEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIIS 62

  Fly    72 DTWVLTAAHCTNGLSSIFLMFGTVDLFNA--------NALNMTSNNIIIHPDYNDKLNNDVSLIQ 128
            :.|:||.        ...|.:..:::..|        :.:.:...|...|.| ||.:   ::|::
  Fly    63 NQWILTV--------KTVLKYSYIEVHLASRRSYRGFDIIRIYKENFRFHYD-NDHV---IALVK 115

  Fly   129 LPEPLTFSANIQAIQLVGQYGDSID-YVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCV 192
            .|.. .|...:..:: |..|....: |||::..:.|:| ||..:....|.:...:||:::|.:|.
  Fly   116 CPYQ-KFDRRMDRVR-VPAYDTRFERYVGNMTMVCGYG-TEKRHAKLPEWMRCIEVEVMNNTECA 177

  Fly   193 AIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILY--NKTIQQWQQIGINSFVAEDQCTYRLP 255
            ..|......:.....:||.|    .|.||.||.::..  |.|.     ||| .::..:.|:...|
  Fly   178 KYYTPLKWYEMCTSGEGFKG----VCEGDIGGAVVTMGPNPTF-----IGI-IWLMPENCSIGYP 232

  Fly   256 SGYARVSSFLGFIADKTGI 274
            |.:.|||..:.:|...:|:
  Fly   233 SVHIRVSDHIKWIKRVSGV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 59/244 (24%)
Tryp_SPc 38..271 CDD:238113 59/246 (24%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 59/244 (24%)
Tryp_SPc 26..248 CDD:304450 59/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471040
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.