DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and spirit

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:247 Identity:73/247 - (29%)
Similarity:114/247 - (46%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IVSGSDAKLGQFPWQVILK-RDAWDDLL---CGGSIISDTWVLTAAHCTN--GLSSIFLMFGTVD 96
            :|.|...:..:||:...|. |..:|..:   |||::|::.:|||||||.:  |.....:..|..:
  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196

  Fly    97 LFNANALNMTSNNIIIHPDYN-DKLNNDVSLIQL-----PEPLTFSANIQAIQLVGQYGDSIDYV 155
            |......:::...:||||||: ....||::|::|     ||........|.           :..
  Fly   197 LTLTEGEDISIRRVIIHPDYSASTAYNDIALLELETAAKPELKPTCIWTQK-----------EVT 250

  Fly   156 GSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGK----YVVVDSTMCAKGFDGSDMS 216
            .::.|..|:|.|....|. |..||...::.:.|.:|...|.|    ..|:.:.|||....| :..
  Fly   251 NTLVTAIGYGQTSFAGLS-SAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITG-ERD 313

  Fly   217 TCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSSFLGFI 268
            ||.|||||||::.:..:  ...:||.|.  ...|....||.|.|||||:.:|
  Fly   314 TCQGDSGGPLLMQDGLL--GYVVGITSL--GQGCASGPPSVYTRVSSFVDWI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 72/245 (29%)
Tryp_SPc 38..271 CDD:238113 73/247 (30%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 73/247 (30%)
Tryp_SPc 132..361 CDD:214473 72/245 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.