DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and Prss30

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:250 Identity:82/250 - (32%)
Similarity:123/250 - (49%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIVSGSDAKLGQFPWQVILKRDAW---DDLLCGGSIISDTWVLTAAHC-TNGLSSIF--LMFG-- 93
            :||.|.||..||:||||.|    |   |..:||||:|.:.|||||||| ...|:..|  :..|  
Mouse    73 KIVGGQDALEGQWPWQVSL----WITEDGHICGGSLIHEVWVLTAAHCFRRSLNPSFYHVKVGGL 133

  Fly    94 TVDLFNANALNMTSNNIIIHPDY--NDKLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVG 156
            |:.|...::..:...||.:||.|  .|..:.|::|:||..||..|   |...:......:....|
Mouse   134 TLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPS---QFTPVCLPAAQTPLTPG 195

  Fly   157 SVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIY--------GKYVVVDSTMCAKGFDGS 213
            :|..:.|:|.|::.  |.:..|....|.::|:.||..:|        |:.::....:|| |:...
Mouse   196 TVCWVTGWGATQER--DMASVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCA-GYVEG 257

  Fly   214 DMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSSFLGFI 268
            ...:|.|||||||:.  .....|.|:||.|:.......|| |..|.||.:::.:|
Mouse   258 QKDSCQGDSGGPLVC--SINSSWTQVGITSWGIGCARPYR-PGVYTRVPTYVDWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 81/248 (33%)
Tryp_SPc 38..271 CDD:238113 81/248 (33%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 81/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.