DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and Mcpt2

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:214 Identity:61/214 - (28%)
Similarity:98/214 - (45%) Gaps:30/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LLCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALNMTSNNI-----IIHPDYNDKLN- 121
            ::|||.:||..:|||||||..  ..|.::.|..|:....:   |...|     |||..||...| 
  Rat    48 VICGGFLISRQFVLTAAHCKG--REITVILGAHDVRKRES---TQQKIKVEKQIIHESYNSVPNL 107

  Fly   122 NDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYT--EDEYLDYSETLLYAQVE 184
            :|:.|::|.:.:..:..:..:.|... .|.| :.|::...||:|.|  .|   ..|.||...::.
  Rat   108 HDIMLLKLEKKVELTPAVNVVPLPSP-SDFI-HPGAMCWAAGWGKTGVRD---PTSYTLREVELR 167

  Fly   185 IIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQ 249
            |:|...||..  :|......:|. |...:..:...|||||||:.....      .||.|:...|.
  Rat   168 IMDEKACVDY--RYYEYKFQVCV-GSPTTLRAAFMGDSGGPLLCAGVA------HGIVSYGHPDA 223

  Fly   250 CTYRLPSGYARVSSFLGFI 268
               :.|:.:.|||:::.:|
  Rat   224 ---KPPAIFTRVSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 60/212 (28%)
Tryp_SPc 38..271 CDD:238113 61/214 (29%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 60/212 (28%)
Tryp_SPc 21..242 CDD:238113 61/214 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.