DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and Prss30

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:278 Identity:87/278 - (31%)
Similarity:135/278 - (48%) Gaps:33/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RSLMLVLLAAISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIIS 71
            |.:.|:||..::  |...|..:|..    .:||.|.||..|::||||.|:.:. :..:||||:|.
  Rat     6 RCIFLLLLQILT--GGRGDILHSGA----GKIVGGQDAPEGRWPWQVSLRTEK-EGHICGGSLIH 63

  Fly    72 DTWVLTAAHC-TNGLSSIF--LMFG--TVDLFNANALNMTSNNIIIHPDY--NDKLNNDVSLIQL 129
            :.|||||||| ...|:|.|  :..|  |:.|...::..:...||.::|.|  .|..:.|::|::|
  Rat    64 EVWVLTAAHCFCRPLNSSFYHVKVGGLTLSLTEPHSTLVAVRNIFVYPTYLWEDASSGDIALLRL 128

  Fly   130 PEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAI 194
            ..||..|   |...:......:....|:|..:.|:|.|.:..|  :..|....|.::|:.||..:
  Rat   129 DTPLQPS---QFSPVCLPQAQAPLTPGTVCWVTGWGATHEREL--ASVLQELAVPLLDSEDCERM 188

  Fly   195 Y--------GKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCT 251
            |        ||.|:....:|| ||......:|.|||||||:....:  .|.|:||.|:..  .|.
  Rat   189 YHIGETSLSGKRVIQSDMLCA-GFVEGQKDSCQGDSGGPLVCAINS--SWIQVGITSWGI--GCA 248

  Fly   252 Y-RLPSGYARVSSFLGFI 268
            . ..|..|.||..::.:|
  Rat   249 RPNKPGVYTRVPDYVDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 79/246 (32%)
Tryp_SPc 38..271 CDD:238113 80/247 (32%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.