DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG18636

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:255 Identity:73/255 - (28%)
Similarity:115/255 - (45%) Gaps:32/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LMLVLLAAISVVGQPFDPANS--SPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIIS 71
            ||..||.  |...|..|||..  :..:...||::|..||....||.|.| ....|..:||||:|:
  Fly    16 LMFQLLH--SGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFL-HSTTDMFVCGGSLIT 77

  Fly    72 DTWVLTAAHCTNGLSSIFLMFGTVDLFNANA-----LNMTSNNII----IHPDYNDKLN-NDVSL 126
            |..|||||||......:....|..:...:..     .|....:::    .|..|:...: ||:::
  Fly    78 DKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAI 142

  Fly   127 IQLPEPLTFSANIQAIQLV-----GQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEII 186
            ::|.:.:.:..||:.|.:|     ..|.|.||    :.|..|:|.|:.|  ..|:.|....:...
  Fly   143 LRLSKSVVYRDNIRPICVVWDHRWRHYLDKID----LLTATGWGKTQME--SDSDALQTLDIRRQ 201

  Fly   187 DNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPL--ILYNKTIQQWQQIGINSF 244
            ....|....|: .:..:..||..:|.   :.|.|||||||  ::.:|..|::.|:||.|:
  Fly   202 PPDVCAKFIGQ-TIAGNQFCAGNWDS---NLCNGDSGGPLGAVITHKNTQRFVQVGIASY 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 64/225 (28%)
Tryp_SPc 38..271 CDD:238113 63/224 (28%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 64/225 (28%)
Tryp_SPc 45..278 CDD:238113 63/224 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.