DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and Sp212

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:280 Identity:79/280 - (28%)
Similarity:128/280 - (45%) Gaps:54/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SVVGQPFDPANSSPIKIDNR-----------------IVSGSDAKLGQFPW--QVILKRDAWDDL 63
            :||..|  ||...|.:.|.|                 ||.|::...||:||  .|..|.......
  Fly   242 AVVTVP--PATPPPQRFDPRSQISSVVCGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAF 304

  Fly    64 LCGGSIISDTWVLTAAHCTNGLSS--IFLMFGTVDL--FNANALNMTS-NNIIIHPDYNDK--LN 121
            .|.||:||.:.|::||||.:.::.  :.:..|..||  :..:...|.: ..::.|||||.:  .:
  Fly   305 KCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSD 369

  Fly   122 NDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVAT---IAGFGYTEDEYLDYSETLLYAQV 183
            .|::||.:..|:||:..|..|.:.     :::...:|:|   |||:|..||     |....|.:|
  Fly   370 ADIALITIERPVTFNDIIAPICMW-----TVEASRTVSTTGFIAGWGRDED-----SSRTQYPRV 424

  Fly   184 ---EIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFV 245
               ||.....|.:.:...:|.:.::||...|||  ..|.|||||.|::  |...:|...||.|  
  Fly   425 VEAEIASPTVCASTWRGTMVTERSLCAGNRDGS--GPCVGDSGGGLMV--KQGDRWLLRGIVS-- 483

  Fly   246 AEDQCTYRLPSGYARVSSFL 265
                ...|.|:|..:::.::
  Fly   484 ----AGERGPAGTCQLNQYV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 72/261 (28%)
Tryp_SPc 38..271 CDD:238113 71/243 (29%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 71/243 (29%)
Tryp_SPc 277..511 CDD:214473 71/243 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436907
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.