DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG30323

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:208 Identity:45/208 - (21%)
Similarity:66/208 - (31%) Gaps:58/208 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 W-DDLLCGGSIISDTWVLTAAHCT--------NGLSSIFLMFGTVDLFNANALNMTSNNIIIHPD 115
            | |:..|.||::|..||:|:..|.        |..|:...:  .|.:|....|...|...|.|. 
  Fly    48 WGDNHFCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNL--RVVVFTPKRLKKPSPKNIYHV- 109

  Fly   116 YNDKLNNDVSLI----------------------QLPEPLTFSANIQAIQLVGQYGDS----IDY 154
              .|:..|.|.|                      .|||     ..:.:..|....|..    :.|
  Fly   110 --QKIVLDESAISGCTELALLKLDRGVTGQRFAMMLPE-----KELNSTWLCNSLGWGRIYYVSY 167

  Fly   155 VGSVATIAGFGYTEDE----YLD--YSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGS 213
            |...|....|....|.    :.|  ||..|:..:.:.|...:|.....:      .:|...:.|.
  Fly   168 VYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSR------CLCMTSYTGR 226

  Fly   214 DMSTCTGDSGGPL 226
            . :.|..|.|.||
  Fly   227 G-NMCQQDLGSPL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 45/208 (22%)
Tryp_SPc 38..271 CDD:238113 45/208 (22%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 45/208 (22%)
Tryp_SPc 45..272 CDD:214473 45/208 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471245
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.