DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG30286

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:271 Identity:64/271 - (23%)
Similarity:112/271 - (41%) Gaps:64/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNGLSSIFLMFGT 94
            ||..:.|   ....|.:.:.||...|.:..  :|:|||::::..::||||||.....::     |
  Fly    30 SPEALQN---EEHQAHISESPWMAYLHKSG--ELVCGGTLVNHRFILTAAHCIREDENL-----T 84

  Fly    95 VDLFNANALNMTSNN---------------IIIHPDYNDKLN--NDVSLIQLPEPLTFSANIQAI 142
            |.|...|:|.....|               ...|..|: :.|  :|:.|::|.:.:.:..:|:.|
  Fly    85 VRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYS-RTNRIHDIGLLRLAKSVEYKVHIKPI 148

  Fly   143 QLVGQ--YGDSIDYVGS-VATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVD-- 202
            .|:..  ....|:.:.. |||  |:|.:..|..::  .|...:|..::...|...|.    ||  
  Fly   149 CLITNTTLQPKIERLHRLVAT--GWGRSPSEAANH--ILKSIRVTRVNWGVCSKTYW----VDRR 205

  Fly   203 -STMCAKGFDGSDMSTCTGDSGGPL---------ILYNKTIQQWQQIGINSFVAEDQCTYRLPSG 257
             ..:|.....|   .:|:||||||:         :|:       .|:||.|: ...:|.  .||.
  Fly   206 RDQICVSHESG---VSCSGDSGGPMGQAIRLDGRVLF-------VQVGIVSY-GNAECL--SPSV 257

  Fly   258 YARVSSFLGFI 268
            :..|...:.:|
  Fly   258 FTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 60/262 (23%)
Tryp_SPc 38..271 CDD:238113 61/263 (23%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 61/259 (24%)
Tryp_SPc 39..268 CDD:214473 60/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.