DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG30187

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:260 Identity:63/260 - (24%)
Similarity:114/260 - (43%) Gaps:52/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVD 96
            |.|..:|..|.:|......|...:....  ..:|||::|...:|||||||        ::...|.
  Fly    30 INIALKITGGHNAAFQNSVWMAAVHNRT--HFICGGTLIHKRFVLTAAHC--------IVDQDVQ 84

  Fly    97 LFNANALNMTSN-------NIIIHPDYNDKLN--NDVSLIQLPEPLTFSANIQAIQLVGQYGDSI 152
            ..:..|.|.:..       ..::|..::.:.:  ||:.|::|...:.|:|.|:.|.:|  ...|:
  Fly    85 SVSLGAYNKSDPADRKDVITAVVHSSFDVRASYENDIGLLKLSSDVIFNALIRPICIV--LNKSM 147

  Fly   153 -DYVGSVATIAGFGY---TEDEYLDYSETLLYAQVEIIDNADC---VAIYGKYVVVDSTMCAKGF 210
             :::.::.|...||:   ..::..|..:|::   :..:|..:|   :::|..    :..:|| |.
  Fly   148 ANHMRNMRTFKAFGWGTLRGNKTSDILQTII---LNHLDREECYMELSVYPS----EKQICA-GV 204

  Fly   211 DGSDMSTCTGDSGGPLI-------LYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSSFLGFI 268
            ...|  ||.|||||||.       :.|:.:    |.||.| |.:..|..:  ..|..:.||..:|
  Fly   205 PSGD--TCGGDSGGPLTNDVFIQGIGNREV----QFGIIS-VGKTSCDGQ--GVYTDLMSFADWI 260

  Fly   269  268
              Fly   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 60/253 (24%)
Tryp_SPc 38..271 CDD:238113 61/254 (24%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 60/253 (24%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.