DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG30098

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:245 Identity:66/245 - (26%)
Similarity:111/245 - (45%) Gaps:38/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNAN 101
            |::.|.:|:  :.||...|.||  :...||||:|:..:||||||||....::|:..|..|.....
  Fly    36 RVIGGQNAR--RTPWMAYLIRD--NRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTT 96

  Fly   102 ALNMTSNNIII---HPDYNDKLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVA---- 159
            .....|..::.   |.:|.|..|:|:::::|...:.:.|.|:.|.::...|     :.|:|    
  Fly    97 DGQTRSYRVVSIYRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSG-----LQSLANSIQ 156

  Fly   160 --TIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDS 222
              |:.|:|... .|.....||....:..:.|..|       .|...::|..   ......|.|||
  Fly   157 NFTLTGWGQMA-HYYKMPTTLQEMSLRRVRNEYC-------GVPSLSICCW---NPVQYACFGDS 210

  Fly   223 GGP---LILY-NKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSSFLGFI 268
            |||   |:.| :|||  :.|.|:.:.|..:...|   |.|..:.|::.::
  Fly   211 GGPLGSLVKYGHKTI--YVQFGVTNSVTGNCDGY---SSYLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 66/243 (27%)
Tryp_SPc 38..271 CDD:238113 65/244 (27%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 66/242 (27%)
Tryp_SPc 37..258 CDD:238113 65/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.