DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and TPSD1

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:244 Identity:75/244 - (30%)
Similarity:121/244 - (49%) Gaps:25/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALNSERSLMLVLLAAISVVGQP--FDPANSSPIKIDNRIVSGSDAKLGQFPWQVILK-RDAWDD 62
            |.|.:.:.|.|:|| |:.|:..|  ..||....:: ...||.|.:|...::||||.|: |..:..
Human     1 MLLLAPQMLSLLLL-ALPVLASPAYVAPAPGQALQ-QTGIVGGQEAPRSKWPWQVSLRVRGPYWM 63

  Fly    63 LLCGGSIISDTWVLTAAHCT----NGLSSIFLMFGTVDLFNANALNMTSNNIIIHPD-YNDKLNN 122
            ..||||:|...||||||||.    ..|:::.:......|:..:.| :..:.||:||. |..:...
Human    64 HFCGGSLIHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQDQL-LPVSRIIVHPQFYIIQTGA 127

  Fly   123 DVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDE-YLDYSETLLYAQVEII 186
            |::|::|.||:..|::|..:.|  .........|....:.|:|..::. :|.....|...:|.::
Human   128 DIALLELEEPVNISSHIHTVTL--PPASETFPPGMPCWVTGWGDVDNNVHLPPPYPLKEVEVPVV 190

  Fly   187 DNADCVAIY--GKY------VVVDSTMCAKGFDGSDMSTCTGDSGGPLI 227
            :|..|.|.|  |.:      :|.|..:|| |.:..|  :|.|||||||:
Human   191 ENHLCNAEYHTGLHTGHSFQIVRDDMLCA-GSENHD--SCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 64/206 (31%)
Tryp_SPc 38..271 CDD:238113 64/205 (31%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 64/205 (31%)
Tryp_SPc 38..240 CDD:214473 64/205 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.