DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and St14

DIOPT Version :10

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_036010597.1 Gene:St14 / 19143 MGIID:1338881 Length:875 Species:Mus musculus


Alignment Length:251 Identity:70/251 - (27%)
Similarity:120/251 - (47%) Gaps:22/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHC----TNGLSSIFLMF----G 93
            |:|.|::|..|::||||.| .......|||.|:||..|:::||||    .|...|.:.|:    |
Mouse   634 RVVGGTNADEGEWPWQVSL-HALGQGHLCGASLISPDWLVSAAHCFQDDKNFKYSDYTMWTAFLG 697

  Fly    94 TVDLFNANALNMTS---NNIIIHPDYND-KLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDY 154
            .:|....:|..:..   ..||.||.:|| ..:.|::|::|.:.:.:|..::.|.|..  ...:..
Mouse   698 LLDQSKRSASGVQELKLKRIITHPSFNDFTFDYDIALLELEKSVEYSTVVRPICLPD--ATHVFP 760

  Fly   155 VGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCT 219
            .|....:.|:|:|::.... :..|...::.:|:...|..:..:. :....||. ||....:.:|.
Mouse   761 AGKAIWVTGWGHTKEGGTG-ALILQKGEIRVINQTTCEDLMPQQ-ITPRMMCV-GFLSGGVDSCQ 822

  Fly   220 GDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYR-LPSGYARVSSFLGFIADKTGI 274
            |||||||....|..:.: |.|:.|:  .:.|..| .|..|.|:.....:|.:.||:
Mouse   823 GDSGGPLSSAEKDGRMF-QAGVVSW--GEGCAQRNKPGVYTRLPVVRDWIKEHTGV 875

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 67/243 (28%)
St14XP_036010597.1 SEA 108..198 CDD:460188
CUB 247..352 CDD:238001
CUB 360..464 CDD:238001
LDLa 474..506 CDD:238060
LDLa 512..543 CDD:238060
LDLa 545..579 CDD:238060
LDLa 587..622 CDD:238060
Tryp_SPc 635..872 CDD:238113 67/245 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.