DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and try-5

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:271 Identity:52/271 - (19%)
Similarity:95/271 - (35%) Gaps:79/271 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLMLVLLAAISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISD 72
            |.||.     ...|...:|.:.:|..:..|:    .|:.|.|            :::|||::|:.
 Worm    37 SFMLT-----DAAGNTGNPTHLAPWAVQIRV----KARKGDF------------EVICGGTLITL 80

  Fly    73 TWVLTAAHC-------------TNGLSSIF-----------LMFGTVDLFNANALNMTSNNIIIH 113
            ..|||||||             .|.:|..:           ::..||....|....:......::
 Worm    81 KHVLTAAHCFQKHFGAKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTVGAMCTRLEQKYGCVN 145

  Fly   114 PDYNDKL------------------NNDVSLIQLPEPL--TFSANIQAIQLVGQYGDSIDYVGSV 158
            ...|.|.                  .||:.:::|...:  ...||...:..:.:..     :.|.
 Worm   146 EKQNGKTLKISRFAIGDFYKTHCEQGNDIVILELESTIDDVEGANYACLPFLPEVN-----IQSG 205

  Fly   159 ATIAGFGYTEDEYLDYSETLLYAQVEII-----DNADCVAIYGKYVVVDSTMCAKGFDGSDMSTC 218
            |.:..||:..|....: :...:..::::     ..|.|...:|..:..||...|   :..|.:.|
 Worm   206 ANVTSFGWGSDPGKGF-DNAAFPMIQVLTLATETLATCEENWGTSIPFDSFCTA---EEEDKNVC 266

  Fly   219 TGDSGGPLILY 229
            :|||||.|..:
 Worm   267 SGDSGGGLTFH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 46/242 (19%)
Tryp_SPc 38..271 CDD:238113 45/241 (19%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 48/255 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.