DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and try-10

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:205 Identity:52/205 - (25%)
Similarity:87/205 - (42%) Gaps:67/205 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LCGGSIISDTWVLTAAHCTNGLSSIF----------LMFGTVDL---------FNANALNMTSNN 109
            :|||.:|:.:.|:|:|||      :|          :..|.|.|         |.::|:.::.. 
 Worm   103 VCGGVLIAPSIVITSAHC------VFSGDDFAVTAKVTLGDVHLNKHDDGEQEFRSHAMAISKK- 160

  Fly   110 IIIHPDYND--KLNNDVSLIQLPE----------------PLTFSANIQAIQLVGQYGDSIDYVG 156
                 .:||  :.|:||::|.||:                |.|.|.|.:....:.|    :....
 Worm   161 -----FFNDASEANDDVAVIFLPQRADVCHSPLSLQIAKLPSTGSVNFKETAPLTQ----LQLET 216

  Fly   157 SVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYG--KYVVVDSTMCAKGFDGSDMSTCT 219
            ||..:||:|.||::...||:::....|.:     .|...|  ||::      ||...||..: |.
 Worm   217 SVCYVAGWGKTENKTAKYSDSVRQMMVNL-----SVRRIGKRKYLI------AKAVTGSSRA-CM 269

  Fly   220 GDSGGPLILY 229
            ||||.|:..:
 Worm   270 GDSGSPVYCF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 52/205 (25%)
Tryp_SPc 38..271 CDD:238113 52/205 (25%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 52/205 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.