DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and Tpsb2

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:284 Identity:87/284 - (30%)
Similarity:128/284 - (45%) Gaps:45/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MLVLLAAISVVGQPFDPANSSPIKIDNR--IVSGSDAKLGQFPWQVIL--KRDAWDDLLCGGSII 70
            :|:||.|:|::.   ....|:|...:.|  ||.|.:|...::||||.|  |.:.|.. .||||:|
Mouse     5 LLLLLWALSLLA---SLVYSAPRPANQRVGIVGGHEASESKWPWQVSLRFKLNYWIH-FCGGSLI 65

  Fly    71 SDTWVLTAAHCTN-----------GLSSIFLMFGTVDLFNANALNMTSNNIIIHPD-YNDKLNND 123
            ...||||||||..           .|...:|.:|...|        :.|.|::||. |..:...|
Mouse    66 HPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYYGDQLL--------SLNRIVVHPHYYTAEGGAD 122

  Fly   124 VSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFG-YTEDEYLDYSETLLYAQVEIID 187
            |:|::|..|:..|.::..|.|  .........|:...:.|:| ...||.|.....|...:|.|::
Mouse   123 VALLELEVPVNVSTHLHPISL--PPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVE 185

  Fly   188 NADCVAIY--GKY------VVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSF 244
            |:.|...|  |.|      :|.|..:||   ..:...:|.|||||||:.  |....|.|.|:.|:
Mouse   186 NSLCDRKYHTGLYTGDDFPIVHDGMLCA---GNTRRDSCQGDSGGPLVC--KVKGTWLQAGVVSW 245

  Fly   245 VAEDQCTYRLPSGYARVSSFLGFI 268
             .|.......|..|.||:.:|.:|
Mouse   246 -GEGCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 79/255 (31%)
Tryp_SPc 38..271 CDD:238113 79/254 (31%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 79/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.