DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG43336

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:258 Identity:71/258 - (27%)
Similarity:117/258 - (45%) Gaps:49/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNAN 101
            |:.:|:.|.|...||...| .......:||||:|::..|||||||....:.:....|..|   ..
  Fly    37 RVKNGTVASLTSSPWMAFL-HSTDGRFICGGSLITNRLVLTAAHCFLDRTELVARLGEYD---RE 97

  Fly   102 ALNMTSNNIII------------HPDYND-KLNNDVSLIQLPEPLTFSANIQAIQLV-----GQY 148
            ...|..::...            |..||. .:..|:::::|...:.::.||:.|.:|     .:|
  Fly    98 EYEMCHDSYCTYRIEAMVERGFRHRHYNPMTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKY 162

  Fly   149 GDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNA----DCVAIYGKYVVVDSTMCAKG 209
            .||:|.:    |..|:|.||.|    .::   |::..:|.|    :....|....:..:..||  
  Fly   163 IDSLDPL----TGTGWGKTESE----GDS---AKLRTVDLARKHPEVCRRYATLSLTANQFCA-- 214

  Fly   210 FDGSDMST-CTGDSGGP---LILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSSFLGFI 268
              |::.|. |.||||||   ||.|.|: :::.|:||.|| ...||.  :.|.:..|.|::.:|
  Fly   215 --GNERSNLCNGDSGGPVGALIPYGKS-KRFVQVGIASF-TNTQCV--MVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 70/256 (27%)
Tryp_SPc 38..271 CDD:238113 70/257 (27%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 70/256 (27%)
Tryp_SPc 40..271 CDD:238113 69/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.