DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG43110

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:261 Identity:80/261 - (30%)
Similarity:116/261 - (44%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNGLSSIFL 90
            |...:|:.   :|:|||:|  .|...|.:........|||||:||.:.:|||.||| ....::|:
  Fly    27 PCGKTPVP---KIISGSNA--SQQSAQYMAGIFNTTHLLCGGTIIHEDFVLTVAHC-KSTQTLFV 85

  Fly    91 MFGTVDLFNANALNMTSNNI-----IIHPDY-NDKLNNDVSLIQLPEPLTFSANIQ--AIQLVGQ 147
            ..|      |..:|..::.|     |.||.| |....||::|::|...:.|:.|||  .|.|...
  Fly    86 RLG------AYNINHPTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDAT 144

  Fly   148 YGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVD-STMCAKGFD 211
            .|..|.|..:      ||:......:.|:.|....|...:...|....|  :..| ..:||....
  Fly   145 LGKQIRYYNA------FGWGRTRNAEQSDILQRIFVNRTNPMICHLYLG--MSPDPKQICATTDQ 201

  Fly   212 GSDMSTCTGDSGGPLILYNKTIQQWQ----QIGINSFVAEDQCTYRLPSG---YARVSSFLGFIA 269
            |   .||.||||||||  :|...|.:    |.||.|: ...:|     :|   |..||.:.|:||
  Fly   202 G---DTCAGDSGGPLI--SKITYQGKNFDTQFGITSY-GTREC-----NGVGLYTDVSQYSGWIA 255

  Fly   270 D 270
            :
  Fly   256 N 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 76/246 (31%)
Tryp_SPc 38..271 CDD:238113 78/249 (31%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 76/246 (31%)
Tryp_SPc 36..257 CDD:238113 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.