DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and Ctrl

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:262 Identity:81/262 - (30%)
Similarity:130/262 - (49%) Gaps:16/262 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LMLVLLAAISVVGQPFD---PANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSII 70
            |:|.|..::.::|..:.   ||.:..:..:.|||:|.:|..|.:||||.| :|......||||:|
  Rat     2 LLLSLTLSLVLLGSSWGCGVPAITPALSYNQRIVNGENAVPGSWPWQVSL-QDNTGFHFCGGSLI 65

  Fly    71 SDTWVLTAAHCTNGLSSIFLMFGTVD-LFNANALNMTS-NNIIIHPDYN-DKLNNDVSLIQLPEP 132
            :..||:|||||.......|::.|..| ..||..:.:.| :..|.||.:| :.:|||::|::|..|
  Rat    66 APNWVVTAAHCKVTPGRHFVILGEYDRSSNAEPIQVLSISKAITHPSWNPNTMNNDLTLLKLASP 130

  Fly   133 LTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGK 197
            ..::|.:..:.|... .:::. .|......|:|............|....:.::....|...:|.
  Rat   131 ARYTAQVSPVCLASS-NEALP-AGLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQCRQYWGS 193

  Fly   198 YVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVS 262
            . :.||.:||   .|:..|:|.|||||||:....  ..|..|||.|:..|: |..:.|:.|.|||
  Rat   194 R-ITDSMICA---GGAGASSCQGDSGGPLVCQKG--NTWVLIGIVSWGTEN-CNVQAPAMYTRVS 251

  Fly   263 SF 264
            .|
  Rat   252 KF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 75/231 (32%)
Tryp_SPc 38..271 CDD:238113 74/230 (32%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 75/231 (32%)
Tryp_SPc 34..260 CDD:238113 74/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.