DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG42694

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:217 Identity:49/217 - (22%)
Similarity:96/217 - (44%) Gaps:30/217 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LLCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALN----MTSNNIIIHPDYNDKLNND 123
            :||.||:||..:||:||.|.:....:|:..|.     :||..    .|.:|::|......:|..|
  Fly    56 VLCSGSLISKQFVLSAAQCIDVHGKLFVQLGV-----SNATKSPHWYTVSNVVIPSHSGKRLQRD 115

  Fly   124 VSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYS---ETLLYAQVEI 185
            :.|::|.:.:.::..:..| .:....:::|.|..:.     .:|...:|..:   :|::.:|:  
  Fly   116 IGLLKLSQSVDYNDFVYPI-CIALNTNTLDMVKILQ-----NFTTSAWLSKNKNPQTIVLSQL-- 172

  Fly   186 IDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPL---ILYNKTIQQWQQIGINSFV-A 246
              :.|...:.....|....:||.....:  ::|..|||..|   |:....|.:....||..:| .
  Fly   173 --SRDRCKLNLSGNVTPKEICAASLQRN--NSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNG 233

  Fly   247 EDQCTYRLPSGYARVSSFLGFI 268
            ...|:.  |:.|..|:..:|:|
  Fly   234 RSWCSE--PAIYIDVAECVGWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 48/215 (22%)
Tryp_SPc 38..271 CDD:238113 49/217 (23%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 49/217 (23%)
Tryp_SPc 46..253 CDD:214473 48/215 (22%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.