DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and cela1.2

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:278 Identity:87/278 - (31%)
Similarity:141/278 - (50%) Gaps:34/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RSLMLVLLAAISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDL-----LCG 66
            |.|:|.:||.:::.    :|.....|.|:.|:|.|..||...:|||:.|:   :.||     .|.
Zfish     3 RILLLSVLATLALA----EPRYLKDIAIEERVVGGEIAKPHSWPWQISLQ---YSDLGTYYYYCS 60

  Fly    67 GSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALN--MTSNNIIIHPDYNDKLNN-----DV 124
            |::|...||:.||||...|....:..|..|::......  ::.:.:.|||::|.  ||     |:
Zfish    61 GTLIRPGWVMVAAHCVEALRKWTVALGDHDIYTHEGPEQYISVSEVFIHPNWNP--NNVAFGYDI 123

  Fly   125 SLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNA 189
            :|::|....|.|:.:|...|... |:.:.| |....|.|:||||... ..|..|..|.:.::|..
Zfish   124 ALLRLSIDATLSSYVQVATLPSS-GEILPY-GHTCYITGWGYTETGG-SLSAQLKQAYMPVVDYE 185

  Fly   190 DCVA--IYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPL-ILYNKTIQQWQQIGINSFVAEDQC- 250
            .|..  .:|. .|.::.:||.|  .:.||.|.||||.|| .|:|   .::...|:.|||:.:.| 
Zfish   186 TCSQKDWWGS-SVKETMICAGG--TTSMSACHGDSGSPLNCLFN---GKYVVHGVTSFVSPEGCN 244

  Fly   251 TYRLPSGYARVSSFLGFI 268
            ||:.|:|:.|||:::.:|
Zfish   245 TYKKPTGFTRVSAYINWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 78/246 (32%)
Tryp_SPc 38..271 CDD:238113 78/247 (32%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 78/246 (32%)
Tryp_SPc 30..265 CDD:238113 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.