DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpIIIC160 and ubxn7

DIOPT Version :9

Sequence 1:NP_001096987.2 Gene:RpIIIC160 / 32524 FlyBaseID:FBgn0030687 Length:1383 Species:Drosophila melanogaster
Sequence 2:NP_001001951.1 Gene:ubxn7 / 402913 ZFINID:ZDB-GENE-040704-8 Length:505 Species:Danio rerio


Alignment Length:461 Identity:88/461 - (19%)
Similarity:151/461 - (32%) Gaps:140/461 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 GPSMHPGANYVQQRGSSFKKYLAYGNREKVAQEL--KCGD----VVERHLRDGDIVLFNRQPSLH 468
            |.:..||.|.:.|:.::..     |..|.|.:.:  .|.:    .|...|..|.|.   .:||..
Zfish     5 GDASAPGVNGLIQQFTAIT-----GATESVGKHMLEACNNNLEMAVTMFLDGGGIA---EEPSTS 61

  Fly   469 KMSIMCHRAKVQPQRTFRFNECACTPYNADFDGDEMNLHLPQTEEARAEALILMGNQSNLVTPKN 533
            ..|.....:::.|..                  ||:...:||.:|...|...|.|      .||.
Zfish    62 ASSARASSSRIPPVE------------------DEVRAPIPQKQEILVEPEPLFG------VPKR 102

  Fly   534 ---GEILIAATQDFITGGYLLTQKEVFLTKEEAMQLAACFLANEDSTMHIKLPPPALLKPRRLWT 595
               ...:....:||        |.|....::|....:|                          .
Zfish   103 RRPARSIFDGFRDF--------QTETIRQEQELRNGSA--------------------------V 133

  Fly   596 GKQMFSL--LMRPNDDSQVRLNMVNKGRNYTRNKDLCSNDSW--IHIRNSELMCGVMDKATMGSG 656
            .|::.:|  |.||      .:.:::||...|........:.|  |:|:|      |.|.|.    
Zfish   134 DKKLSTLADLFRP------PIELMHKGSFETAKDSGQLENKWLMINIQN------VQDFAC---- 182

  Fly   657 TKQCIFYLLLRDFGESHATKAM-------WRL-------ARIASYFLQNRGFSFGISDVTPSKKL 707
              ||    |.||...:.|.|.:       |::       .|...::..|:.....|.|....:|:
Zfish   183 --QC----LNRDVWSNDAVKTIIREHFIFWQVYHDSEEGQRYIQFYKLNKFPYISILDPRTGQKM 241

  Fly   708 LQHKELLLNNGYAKCNEYIELLKAGTLQCQPGCTPEETLESVMLRELS-------AIREQAAKTC 765
            ::..:|.:::...:...:  |.:.|.|..|....|.:...|..|.:.|       |||....:|.
Zfish   242 VEWNQLDVSSFMDQVTGF--LSEHGQLDGQSSQPPAKRARSESLIDASEDSQLEAAIRASLQETH 304

  Fly   766 F------AELHPTNSALIMALSGSKG-SNINISQMIACVGQQAISG---------KRVPNGFENR 814
            :      ||....:.:.....|.|:| .:::.|...|..|:.::.|         .|..:...:|
Zfish   305 YESTQEKAESRSDDDSDAEPFSDSEGLISVDGSDNEAGAGEDSLDGHTSTELAPPTRSDSPAHHR 369

  Fly   815 ALPHFE 820
            ..||.|
Zfish   370 KSPHKE 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpIIIC160NP_001096987.2 PRK08566 13..919 CDD:236292 88/461 (19%)
RNAP_III_RPC1_N 24..889 CDD:259847 88/461 (19%)
RNA_pol_Rpb1_5 839..1304 CDD:282807
RNAP_III_Rpc1_C 1013..1353 CDD:132723
ubxn7NP_001001951.1 UBA_UBXD7 15..50 CDD:270530 6/39 (15%)
UAS 151..263 CDD:239256 25/129 (19%)
UBQ 424..505 CDD:294102
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.