DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL3 and RPL3

DIOPT Version :9

Sequence 1:NP_511166.2 Gene:mRpL3 / 32523 FlyBaseID:FBgn0030686 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_014706.1 Gene:RPL3 / 854229 SGDID:S000005589 Length:387 Species:Saccharomyces cerevisiae


Alignment Length:336 Identity:77/336 - (22%)
Similarity:119/336 - (35%) Gaps:74/336 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GNSSVLVTQVRDKGHLSRPRLRNPQWFLRKEITKYNDLMTAENKQFVNEVGTNNFGVPAVIKDSL 80
            |..:.:.|.|||   |.||..:    |.::|:.           :.|..|.|....|..|:  ..
Yeast    48 GYKAGMTTIVRD---LDRPGSK----FHKREVV-----------EAVTVVDTPPVVVVGVV--GY 92

  Fly    81 VKT-AGPTANEAVWTPNLRRCGVIARKIGQYPLWLKNGERIRTTLLQIVDNHVIKYIPPEEYLPA 144
            |:| .|..:...||..:|  ...:.|:.  |..|.|:.::..|       .:..||......:..
Yeast    93 VETPRGLRSLTTVWAEHL--SDEVKRRF--YKNWYKSKKKAFT-------KYSAKYAQDGAGIER 146

  Fly   145 QVPTVANLHKRGCILVGSETTNPALLTKE--YAGIFRNSGVLPKK-NLAR--FIVSPEAQLAPGT 204
            ::..:........:||.::.....|..|:  .|.|..|.|.:.:| :.||  |    |..:|..:
Yeast   147 ELARIKKYASVVRVLVHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHF----EKTVAVDS 207

  Fly   205 PLNVNHFRVGDFVDVRGKTVDHGFQGVVKRHGFKGMPASHGVTKTHRRAGNIG--GGGEKGRVWP 267
            .     |...:.:|....|..|||:||..|.|.|.:|     .||||....:.  |......|..
Yeast   208 V-----FEQNEMIDAIAVTKGHGFEGVTHRWGTKKLP-----RKTHRGLRKVACIGAWHPAHVMW 262

  Fly   268 GTKMPGHMGNRWRIIKGLRVWRINTKYNVMWVQGSSVA-GPTGGLVYIYDTILPTRKNKEAPPFP 331
            .....|..|...|.....:::|:.        :|...| |.|.     :|     |..|...|..
Yeast   263 SVARAGQRGYHSRTSINHKIYRVG--------KGDDEANGATS-----FD-----RTKKTITPMG 309

  Fly   332 TF--YGEPQQD 340
            .|  |||.:.|
Yeast   310 GFVHYGEIKND 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL3NP_511166.2 RplC 101..314 CDD:294230 47/220 (21%)
RPL3NP_014706.1 PTZ00103 1..387 CDD:240267 77/336 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.