DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL3 and RP1

DIOPT Version :10

Sequence 1:NP_511166.2 Gene:mRpL3 / 32523 FlyBaseID:FBgn0030686 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_175009.1 Gene:RP1 / 840916 AraportID:AT1G43170 Length:389 Species:Arabidopsis thaliana


Alignment Length:34 Identity:10/34 - (29%)
Similarity:19/34 - (55%) Gaps:3/34 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RTKGSEEE--QTSDDPVIEQEEELVQSTDASMRW 43
            |::.::||  :.:.|...:..:|||.|.|.. :|
plant   437 RSQLTKEEWKKLTKDSTTKAVQELVSSPDFG-KW 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL3NP_511166.2 rpl3p 101..314 CDD:444836
RP1NP_175009.1 PTZ00103 1..389 CDD:240267
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.