DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL3 and AT2G43030

DIOPT Version :9

Sequence 1:NP_511166.2 Gene:mRpL3 / 32523 FlyBaseID:FBgn0030686 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_181831.1 Gene:AT2G43030 / 818905 AraportID:AT2G43030 Length:271 Species:Arabidopsis thaliana


Alignment Length:244 Identity:71/244 - (29%)
Similarity:121/244 - (49%) Gaps:15/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VPAVIKDSLVKTAGPTANEAVWTPNLRRCGVIARKIGQYPLWLKNGERIRTTLLQIVDNHVIKYI 136
            :||.....|:|:: |.....|.:......||:..|:|....:.::|..:..|::...:.:::   
plant    29 LPAKSSSLLIKSS-PKTRFVVSSSMEAGIGVMGSKLGMMSFFEEDGTVVPVTVVGFREGNIV--- 89

  Fly   137 PPEEYLPAQVPTVANLHKRGCILVGSETTNPALLTKEYAGIFRNSGVLPKKNLARFIVSPEAQLA 201
                   .|:.|:|. .....:.:|........|||...|..:.:|.:|.::|..|.::......
plant    90 -------TQIKTLAT-DGYDAVQIGYRRVRDKKLTKPETGHLQKAGTIPMRHLQEFRLTNIEGFE 146

  Fly   202 PGTPLNVNH-FRVGDFVDVRGKTVDHGFQGVVKRHGFKGMPASHGVTKTHRRAGNIGGGGEKGRV 265
            |...|..:. |:.||.|||.|.|:..||||.:|||.||....:|| :|:||..|:||.|...|||
plant   147 PNQKLVFDEIFKEGDLVDVAGTTIGKGFQGGIKRHHFKRGQMTHG-SKSHRALGSIGAGTTPGRV 210

  Fly   266 WPGTKMPGHMGNRWRIIKGLRVWRINTKYNVMWVQGSSVAGPTGGLVYI 314
            :.|.||||.||.....|:.|::.:::.:.||:.::| ::.|..|.|:.|
plant   211 YKGKKMPGRMGGTRTKIRKLKIVKVDKELNVVMIKG-ALPGKPGNLLRI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL3NP_511166.2 RplC 101..314 CDD:294230 64/213 (30%)
AT2G43030NP_181831.1 rplC 56..265 CDD:234564 65/216 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1269775at2759
OrthoFinder 1 1.000 - - FOG0003599
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100949
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2474
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.