DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL3 and RPL3

DIOPT Version :9

Sequence 1:NP_511166.2 Gene:mRpL3 / 32523 FlyBaseID:FBgn0030686 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_000958.1 Gene:RPL3 / 6122 HGNCID:10332 Length:403 Species:Homo sapiens


Alignment Length:180 Identity:40/180 - (22%)
Similarity:59/180 - (32%) Gaps:55/180 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 NSGVLPKK-NLARFIVSPEAQLAPGTPLNVNHFRVGDFVDVRGKTVDHGFQGVVKRHGFKGMPAS 243
            |.|.:.:| :.||      .:|....|:| ..|...:.:||.|.|...|::||..|...|.:|  
Human   186 NGGTVAEKLDWAR------ERLEQQVPVN-QVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLP-- 241

  Fly   244 HGVTKTHRRAGNIG--GGGEKGRVWPGTKMPGHMGNRWRIIKGLRVWRI---------------- 290
               .||||....:.  |.....||.......|..|...|.....::::|                
Human   242 ---RKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNA 303

  Fly   291 NTKYNVMWVQGSSVAGPTGGLVYIYDTILPTRKNKEAPPFPTFYGEPQQD 340
            :|.|::    ......|.||.|:                    |||...|
Human   304 STDYDL----SDKSINPLGGFVH--------------------YGEVTND 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL3NP_511166.2 RplC 101..314 CDD:294230 36/152 (24%)
RPL3NP_000958.1 PTZ00103 1..400 CDD:240267 40/180 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.