DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL3 and mrpl3

DIOPT Version :9

Sequence 1:NP_511166.2 Gene:mRpL3 / 32523 FlyBaseID:FBgn0030686 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_005159568.1 Gene:mrpl3 / 336283 ZFINID:ZDB-GENE-030131-8227 Length:345 Species:Danio rerio


Alignment Length:312 Identity:130/312 - (41%)
Similarity:186/312 - (59%) Gaps:25/312 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TKYNDLMTAENKQFVNEVGTNNFGVPAVIKDSLVKTAGPTANEA----VWTPNLRRCGVIARKIG 108
            |.:::.:|.:|..|:.::....:  ..:.||.|    .|..:|.    .|....||.|::|.|:|
Zfish    47 TWWDEHLTEDNASFLKKLTAEEY--DQMTKDRL----NPLKDEPWPRHEWVEGSRRVGLVAIKLG 105

  Fly   109 QYPLWLKNGERIRTTLLQIVDNHVIKYIPPEEYLPAQVPTVANLHKRGCILVGSETTNPALLTKE 173
            ..|:|.|:|||...|:||:.|.||:|::..|:|         |.| ...::||.:..:|......
Zfish   106 MMPVWSKSGERHVVTMLQVKDCHVVKHLSKEDY---------NGH-TSALVVGGKNVSPFHRPVG 160

  Fly   174 YAGIFRNSGVLPKKNLARFIVSPEAQLAPGTPLNVNHFRVGDFVDVRGKTVDHGFQGVVKRHGFK 238
            |..||:|:|:.||:.|..|.|:..|.:.|||||...|||.|.:|||..||:..|||||:||.|||
Zfish   161 YLEIFQNAGIPPKQKLTTFCVTDNAIIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFK 225

  Fly   239 GMPASHGVTKTHRRAGNIGGGGEKGRVWPGTKMPGHMGNRWRIIKGLRVWRINTKYNVMWVQGSS 303
            |.|||||.||||||.|.:|.||:..:|:.||||||.|||.:....||::||:|||||:::|.| |
Zfish   226 GQPASHGQTKTHRRPGALGPGGDPAKVFKGTKMPGRMGNVYNTNFGLKIWRVNTKYNILYVNG-S 289

  Fly   304 VAGPTGGLVYIYDTILPTR--KNKEAPPFPTFYGEPQQD-GDDVWYEQVHNF 352
            |.|....||.:.||:||||  |||.. |||||:.:..:: .:|::.|.:..|
Zfish   290 VPGHRNCLVKVRDTVLPTRLEKNKNL-PFPTFFADGNEELPEDLYDEDMFQF 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL3NP_511166.2 RplC 101..314 CDD:294230 101/212 (48%)
mrpl3XP_005159568.1 rplC 96..304 CDD:234564 103/218 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581634
Domainoid 1 1.000 119 1.000 Domainoid score I5780
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31431
Inparanoid 1 1.050 233 1.000 Inparanoid score I3393
OMA 1 1.010 - - QHG55656
OrthoDB 1 1.010 - - D1269775at2759
OrthoFinder 1 1.000 - - FOG0003599
OrthoInspector 1 1.000 - - oto41494
orthoMCL 1 0.900 - - OOG6_100949
Panther 1 1.100 - - LDO PTHR11229
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1153
SonicParanoid 1 1.000 - - X2474
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.