Sequence 1: | NP_511166.2 | Gene: | mRpL3 / 32523 | FlyBaseID: | FBgn0030686 | Length: | 362 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001001590.1 | Gene: | rpl3 / 322571 | ZFINID: | ZDB-GENE-030131-1291 | Length: | 403 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 50/199 - (25%) |
---|---|---|---|
Similarity: | 66/199 - (33%) | Gaps: | 53/199 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 172 KEYAGIFR-----NSGVLPKKNLARFIVSPEAQLAPGT----------------PLNVNHFRVGD 215
Fly 216 FVDVRGKTVDHGFQGVVKRHGFKGMPASHGVTKTHRRAGNIG--GGGEKGRVWPGTKMPGHMGNR 278
Fly 279 WRIIKGLRVWRINTKYNVMWVQGSSVAGPTGGLV-----YIYDTILPTRKNKEAPPFPTF--YGE 336
Fly 337 PQQD 340 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mRpL3 | NP_511166.2 | RplC | 101..314 | CDD:294230 | 40/169 (24%) |
rpl3 | NP_001001590.1 | PTZ00103 | 1..400 | CDD:240267 | 50/199 (25%) |
RplC | 3..375 | CDD:294230 | 50/199 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0087 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |