DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL3 and rpl3

DIOPT Version :9

Sequence 1:NP_511166.2 Gene:mRpL3 / 32523 FlyBaseID:FBgn0030686 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001001590.1 Gene:rpl3 / 322571 ZFINID:ZDB-GENE-030131-1291 Length:403 Species:Danio rerio


Alignment Length:199 Identity:50/199 - (25%)
Similarity:66/199 - (33%) Gaps:53/199 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 KEYAGIFR-----NSGVLPKKNLARFIVSPEAQLAPGT----------------PLNVNHFRVGD 215
            |:|..|.|     ...:||.:.....::  |.||..||                |: .|.|...:
Zfish   154 KKYCQIIRIIAHTQMRLLPHRQKKSHLM--EIQLNGGTISDKVDWAREKLEQSIPI-ANVFSQDE 215

  Fly   216 FVDVRGKTVDHGFQGVVKRHGFKGMPASHGVTKTHRRAGNIG--GGGEKGRVWPGTKMPGHMGNR 278
            .:||.|.|..||.:||..|...|.:|     .||||....:.  |.....||.......|..|..
Zfish   216 MIDVIGVTKGHGCKGVTSRWHTKKLP-----RKTHRGLRKVACIGAWHPARVAFSVARAGQKGYH 275

  Fly   279 WRIIKGLRVWRINTKYNVMWVQGSSVAGPTGGLV-----YIYDTILPTRKNKEAPPFPTF--YGE 336
            .|.....::::|...|:          ...|.||     ..||.     .||...|...|  |||
Zfish   276 HRTEINKKIYKIGVGYH----------NKDGKLVKNNASTDYDL-----SNKSINPLGGFVHYGE 325

  Fly   337 PQQD 340
            ...|
Zfish   326 VTND 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL3NP_511166.2 RplC 101..314 CDD:294230 40/169 (24%)
rpl3NP_001001590.1 PTZ00103 1..400 CDD:240267 50/199 (25%)
RplC 3..375 CDD:294230 50/199 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.