DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL3 and Rpl3

DIOPT Version :10

Sequence 1:NP_511166.2 Gene:mRpL3 / 32523 FlyBaseID:FBgn0030686 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_038790.2 Gene:Rpl3 / 27367 MGIID:1351605 Length:403 Species:Mus musculus


Alignment Length:180 Identity:40/180 - (22%)
Similarity:59/180 - (32%) Gaps:55/180 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 NSGVLPKK-NLARFIVSPEAQLAPGTPLNVNHFRVGDFVDVRGKTVDHGFQGVVKRHGFKGMPAS 243
            |.|.:.:| :.||      .:|....|:| ..|...:.:||.|.|...|::||..|...|.:|  
Mouse   186 NGGTVAEKLDWAR------ERLEQQVPVN-QVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLP-- 241

  Fly   244 HGVTKTHRRAGNIG--GGGEKGRVWPGTKMPGHMGNRWRIIKGLRVWRI---------------- 290
               .||||....:.  |.....||.......|..|...|.....::::|                
Mouse   242 ---RKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNA 303

  Fly   291 NTKYNVMWVQGSSVAGPTGGLVYIYDTILPTRKNKEAPPFPTFYGEPQQD 340
            :|.|::    ......|.||.|:                    |||...|
Mouse   304 STDYDL----SDKSINPLGGFVH--------------------YGEVTND 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL3NP_511166.2 rpl3p 101..314 CDD:444836 36/152 (24%)
Rpl3NP_038790.2 PTZ00103 1..400 CDD:240267 40/180 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.