DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Graf and rga2

DIOPT Version :9

Sequence 1:NP_001285296.1 Gene:Graf / 32522 FlyBaseID:FBgn0030685 Length:1025 Species:Drosophila melanogaster
Sequence 2:NP_594152.1 Gene:rga2 / 2542682 PomBaseID:SPAC26A3.09c Length:1275 Species:Schizosaccharomyces pombe


Alignment Length:492 Identity:109/492 - (22%)
Similarity:188/492 - (38%) Gaps:130/492 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 KFDKKTEKFCQSQERFLNM---STKKP-----ENTIQEADASLGMHEREYIQESLSYVLRIQEVQ 197
            :|..|.:....|||..|:.   |:..|     ||....||.||        ..:|:...::::..
pombe   868 RFYGKADSRPVSQEAILSQDISSSPSPVLPPSENVASYADDSL--------VSNLTMSPKLRDSM 924

  Fly   198 ERIKFEFVEILLAFISGWLVFYHTAHEQAEDHRDYLQDLRHKVQKTRENFEEAREKVTEL----- 257
            |::..                        |:||::  ::..:|.:.  :|:.:...|.|:     
pombe   925 EQVPL------------------------ENHREF--EISDRVSEL--SFDSSTGSVLEIADTRR 961

  Fly   258 KTKYMEKRTKPEEIFTKRGYLFLMEKSSILKISLLEPFKATWTKYYCTFKKQKREFTMLQFNQMN 322
            .....||.....||.:.|..|...::|:.::                           |..:..:
pombe   962 NQDAPEKHVPVIEIQSSRPSLEKTDQSTPVE---------------------------LLIDSHS 999

  Fly   323 HNFTRPEARDDEKLTLFSCQRRASEFEKRFCFDLTFKEKPGVVYTFQALSEKDHRYWISAMDGTE 387
            .|....|.|...|...|. ..:|..:|:     ::....| |:.|...||.       |:....|
pombe  1000 QNSQNEEKRSRMKFWAFP-HHKAENYEQ-----ISDTNIP-VIETNVMLSP-------SSTTSAE 1050

  Fly   388 P----------TYLAPGKIKVSEAYHLDEAGF-MFIRRCIQVLE-IRGLEDEGIYRKSGVGTKIS 440
            |          .:..|....|:.:...:::|. :.:.|||:.|| .|..::|||||.||..:.| 
pombe  1051 PLQKHIVRKSGIFGLPLNEAVNISTQFNDSGLPIVVYRCIEYLESCRAEKEEGIYRLSGSASTI- 1114

  Fly   441 KLLALGLNQKESDDVFVDDKYRDLMESNTIASALKMYLRNLNEPLMTYQYHSDFIEAAKQETLNQ 505
            |.|....|:....|:...|:..|:   :.||..||:|||||...|:....|..|.........:.
pombe  1115 KHLKEQFNEGVDYDLLSSDEEFDV---HVIAGLLKLYLRNLPTNLLDTSMHKLFELLPNVPNDSA 1176

  Fly   506 RVNEVHKLVYKLPQPNFQMLDMVICHLTDVSRKYEKNKMSVFNLGVVFGPTLLRPREESVAAILD 570
            .:.|:..::.|||..||.:||.::.||..:....:.|||::.|:.:||.|||..|.:        
pombe  1177 ALGELCDVISKLPPENFALLDSLLHHLRRIIAFEKVNKMNIRNVCIVFSPTLNIPSD-------- 1233

  Fly   571 IKFNNIVINILIDNYERIF----------KNKPSADI 597
                  :..:||.||:.||          :|:..:|:
pombe  1234 ------IFMMLILNYDHIFTDISRQTNGAQNESDSDV 1264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GrafNP_001285296.1 BAR_RhoGAP_OPHN1-like 27..233 CDD:153286 19/99 (19%)
BAR-PH_GRAF_family 273..390 CDD:269953 19/126 (15%)
PH 279..383 CDD:278594 15/103 (15%)
RhoGAP 383..584 CDD:295372 59/212 (28%)
SH3_GRAF-like 967..1020 CDD:212815
rga2NP_594152.1 PH-like 720..833 CDD:302622
PH 722..836 CDD:278594
RhoGAP_fBEM3 1062..1249 CDD:239865 61/204 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.