DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Graf and rga-1

DIOPT Version :9

Sequence 1:NP_001285296.1 Gene:Graf / 32522 FlyBaseID:FBgn0030685 Length:1025 Species:Drosophila melanogaster
Sequence 2:NP_001022390.1 Gene:rga-1 / 174751 WormBaseID:WBGene00012203 Length:444 Species:Caenorhabditis elegans


Alignment Length:267 Identity:74/267 - (27%)
Similarity:118/267 - (44%) Gaps:35/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 ASEFEKRFCFDLTFKEKPGVVYTFQALSE---------KDHRYWISAMDG---TEPTYLAP-GKI 396
            :|:||.:|.:.:...|..      .|||.         :||....|....   |.|....| .:.
 Worm   189 SSKFENKFHYVMCIDELE------NALSVARLNLPSPIRDHDKSFSTQSNRPETPPAQPLPTQQF 247

  Fly   397 KVSEAYHLDEAGF---MFIRRCIQVLEIRGLEDEGIYRKS-GVGTKISKLLALGLNQKESDDVFV 457
            .|...:.|...|.   ..:.:.|:.||...|..||::||| .:|:  .|.|...:|:.|..|...
 Worm   248 GVPLEFILSHCGGNIPPIVDQLIEYLEAHALTMEGVFRKSANIGS--IKRLQDRINKGEKIDFEN 310

  Fly   458 DDKYRDLMESNTIAS-----ALKMYLRNLNEPLMTYQYHSDFIEAAKQETLNQRVNEVHKLVYKL 517
            |.:|:|   :..:||     .||.:.|:|.|||.|.:.:.. :.|..:.:..::...|.:.|..|
 Worm   311 DPEYKD---NEYVASLHASVLLKTFFRSLGEPLTTNRLYPK-LAALSEVSKTEKSAAVKEFVKLL 371

  Fly   518 PQPNFQMLDMVICHLTDVSRKYEKNKMSVFNLGVVFGPTLLRPREESVAAILDIKFNNIVINILI 582
            |:.|:.:|..||..||.|:...:.|.|:..||.|||||.|..|.::.|........||....:::
 Worm   372 PRENYILLKTVIKFLTRVAENSKVNLMTANNLSVVFGPNLTWPTDQEVPISQLNNLNNFCYKLIV 436

  Fly   583 DNYERIF 589
            | |:.:|
 Worm   437 D-YDSVF 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GrafNP_001285296.1 BAR_RhoGAP_OPHN1-like 27..233 CDD:153286
BAR-PH_GRAF_family 273..390 CDD:269953 13/56 (23%)
PH 279..383 CDD:278594 11/46 (24%)
RhoGAP 383..584 CDD:295372 60/213 (28%)
SH3_GRAF-like 967..1020 CDD:212815
rga-1NP_001022390.1 SEC14 74..225 CDD:214706 10/41 (24%)
RhoGAP 242..442 CDD:383032 60/206 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.