DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8260 and CG10752

DIOPT Version :9

Sequence 1:NP_573069.1 Gene:CG8260 / 32521 FlyBaseID:FBgn0030684 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_648614.1 Gene:CG10752 / 39467 FlyBaseID:FBgn0036325 Length:539 Species:Drosophila melanogaster


Alignment Length:381 Identity:83/381 - (21%)
Similarity:155/381 - (40%) Gaps:84/381 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FINVRTRERLCYLEQTFLNFANSIRTLKEDPTESEI-VEIDHEVPPEEYLVPYIQNYECADIIVT 101
            |::.|.:|.:.|      |...:....|:.|.:.:: :.::..:.|..|::              
  Fly    26 FMSNRLKEHMKY------NILRNAVFYKKIPLQKKLKLALERNIGPHAYII-------------- 70

  Fly   102 VHDRVFLCHNIILSIYSRRMLKILQEDVDHIVFKSNDLSPKGFSDAYLWMISS------DGEVNP 160
            |:|.::.|...:|.||.:.....|:.. |.:.|..:.:|.:.|..||.||.::      |..:| 
  Fly    71 VNDTIYKCQVFVLRIYCKLFTNNLKRG-DIVKFPRDAMSNECFELAYTWMTNNAIHLPRDKIIN- 133

  Fly   161 CDMGEILRAAYFLDIPELLEACWANL-DRITFFEISAFRLLFELR--GATNLWDVFDKLTGRISI 222
                 :|.||..|....|::..:..| |..|..|:.:|....:.:  |.|   .|.|.:..|::.
  Fly   134 -----LLAAAKCLQCIPLIKRIFEFLNDYRTHCELFSFSCYLKAKDMGMT---QVADMMVSRVTK 190

  Fly   223 SILPVASTREFLCLSETQICYILKSNFLAINSEME---------ASSISIRRSSTYRVLSQIRFS 278
            |.|.:.|..:|:.:.....|.:|:|..||:.:|:|         .|:..:|.....||||.:||.
  Fly   191 SFLVLVSNGQFIKMDIDGACTLLRSRHLAVQNEIEIFYSALLWLISNYEMRIKYIPRVLSLVRFL 255

  Fly   279 FLPPLMLKKFRSEELHKMPEFSDILKEFSKSPDVITLLRDSVFNSSLLLTVRNNPSVLDTHVEFT 343
            .:|.:.:.::.|......||.:::|..|             :.|:.|        |..:.:.|..
  Fly   256 MIPAVFILQWTSNLKDLRPELANVLCHF-------------LHNAML--------SQFEYYTETF 299

  Fly   344 EVE--LMEPRHWVQDHTCDY-----HRKVTQLCPNMRFITLNEYQEYLKRLSIGPE 392
            :.|  :...|.|.||..|.|     ....:.|.|::.|       .||:::...|:
  Fly   300 QSESIIRGNRRWAQDPQCPYLSLFNANGDSDLSPDVFF-------RYLRQIQNSPK 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8260NP_573069.1 BTB 91..182 CDD:295341 22/96 (23%)
BTB 97..190 CDD:197585 24/99 (24%)
BACK 200..287 CDD:197943 25/97 (26%)
DUF4734 308..387 CDD:292506 16/85 (19%)
CG10752NP_648614.1 BACK 172..264 CDD:197943 25/94 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.