DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8260 and CG9970

DIOPT Version :9

Sequence 1:NP_573069.1 Gene:CG8260 / 32521 FlyBaseID:FBgn0030684 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_647754.1 Gene:CG9970 / 38351 FlyBaseID:FBgn0035380 Length:484 Species:Drosophila melanogaster


Alignment Length:399 Identity:81/399 - (20%)
Similarity:153/399 - (38%) Gaps:53/399 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SKLINSQCPYVHFINVRTRERLCYLEQTFLN--------FANS---------IRTLKEDPTESEI 73
            |...:...|.|....:..::|...|.:||.:        |.:|         ...:|..|..:||
  Fly    60 STTTDGDLPTVKMDKILQQQRAELLWKTFTDEEYSDWKTFKDSNYKVPLLSVFSYVKSKPFIAEI 124

  Fly    74 VEIDHEVPPEEYLVPYIQNYECADIIVTVHDRVFLCHNIILSIYSRRMLKILQEDVDHIVFKSND 138
            ..:..::...:.:...:::...|..:|.:.:..|.|...:|..:| ....|....:....||..:
  Fly   125 PNLPPKISGPQLMTNILKSNYGALALVQIGENKFKCIPCLLRCFS-VWFGIRDWRITRFKFKERE 188

  Fly   139 LSPKGFSDAYLWM----ISSDGEVNPCDMGEILRAAYFLDIPELLEACWANLDRITFFEISAFRL 199
            :...||...|.||    :....|:.|.     |:.|..|.:..|.:..|..|...:..|..||.:
  Fly   189 VPSGGFKVVYEWMRTNKLPEFDELVPA-----LQVACHLKVTLLEKEIWQILSDESVREKVAFLV 248

  Fly   200 LFELRGATNLWDVFDKLTGRISISILPVASTREFLCLSETQICYILKSNFLAINSEMEASSISI- 263
            ....|....|..:.:.:..|:....|.:..:..|:.|....:..:|:.:.:.:|||||.....| 
  Fly   249 YLGARRMPALGALCEAMLFRLRKYFLALVGSPHFVRLKVDVLEMLLRQDSIGVNSEMEVFFAVIR 313

  Fly   264 ---------RRSSTYRVLSQIRFSFLPPLMLKKFRSEELHKMPEFSDILKE------FSKSPDVI 313
                     ||....|::..:||..:|...|...|....|  ||..|:..:      |:..|:::
  Fly   314 WLGHSRGRKRREHFQRLMKCVRFHHMPMTFLFSLRESFNH--PEKFDLFSKEPGMLAFNTDPEMM 376

  Fly   314 TLLRDSVFNSSLLLTVRNNPSVLDTHVEFTE---VELMEPRHWVQDHTCDYHRKVTQLCPNMRFI 375
            .||..:::    .::||.....::..:...|   :|::.||.||....|.:|.:........|| 
  Fly   377 ELLEHAIY----FISVRTQCDDINEFLSTCESHHIEVVLPRWWVYHVNCPFHLRTIDFPYQHRF- 436

  Fly   376 TLNEYQEYL 384
            |..::.:|:
  Fly   437 TATDFGDYI 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8260NP_573069.1 BTB 91..182 CDD:295341 20/94 (21%)
BTB 97..190 CDD:197585 21/96 (22%)
BACK 200..287 CDD:197943 20/96 (21%)
DUF4734 308..387 CDD:292506 17/80 (21%)
CG9970NP_647754.1 BACK 254..346 CDD:197943 19/91 (21%)
DUF4734 373..450 CDD:292506 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469521
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.