DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8260 and CG12692

DIOPT Version :9

Sequence 1:NP_573069.1 Gene:CG8260 / 32521 FlyBaseID:FBgn0030684 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001284857.1 Gene:CG12692 / 31372 FlyBaseID:FBgn0029703 Length:553 Species:Drosophila melanogaster


Alignment Length:291 Identity:66/291 - (22%)
Similarity:114/291 - (39%) Gaps:47/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VTVHDRVFLCHNIILSIYS----RRMLKILQEDVDHIVFKSNDLSPKGFSDAYLWMISS---DGE 157
            |.:....|.|.:.:|..:|    |.:..:      :...:..||...||..||.||...   |..
  Fly    65 VCIGTSTFWCTSSLLQFHSNYFDRNICPV------NCFREGTDLIAVGFRAAYTWMRLQEPLDPF 123

  Fly   158 VNPCDMGEILRAAYFLDIPELLEACWANLDRITFFEISAFRLLFELRGATNLWDVFDKLTGRISI 222
            :.|..:..:|..|..|::|.|...|:..|....|.|.:||::.........|.::...:..||..
  Fly   124 MQPDKLMTLLHTAVQLEMPALKALCYEQLCTDRFREETAFQVYLRALKYPQLEELRKLMLQRIGA 188

  Fly   223 SILPVASTREFLCLSETQICYILKSNFLAINSEMEASSISIR---------RSSTYRVLSQIRFS 278
            :.|.|....:|..:....:..:|:.:.|.:|||||.....||         ..:|..::..:|.:
  Fly   189 AFLAVLGGDDFQRMPLEDVITMLQQDSLGVNSEMEVLVAIIRWLNCQSKCIDQATPLLMDCLRLT 253

  Fly   279 FLPPLMLKKF-RSEELHKMPEFSDILKEFSKSPDVITLLRDSVFNSSLLLTVRNNPSVLDTHVEF 342
            .||..:||:| |......:|:     :.|..:......:|:.:   |..:||     |...|:..
  Fly   254 LLPLPILKRFWRCAMAPPVPD-----EPFMNAVRGNIHIRERI---SCAITV-----VQMHHLHT 305

  Fly   343 TEVELME-----------PRHWVQDHTCDYH 362
            :..|.::           ||.|:.|..|.||
  Fly   306 SRREFLDFCRSKGLLVDMPREWIYDEQCHYH 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8260NP_573069.1 BTB 91..182 CDD:295341 21/88 (24%)
BTB 97..190 CDD:197585 23/96 (24%)
BACK 200..287 CDD:197943 20/95 (21%)
DUF4734 308..387 CDD:292506 14/66 (21%)
CG12692NP_001284857.1 BACK 162..265 CDD:285009 24/102 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469525
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.