DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8260 and CG10801

DIOPT Version :9

Sequence 1:NP_573069.1 Gene:CG8260 / 32521 FlyBaseID:FBgn0030684 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_570058.1 Gene:CG10801 / 31314 FlyBaseID:FBgn0029660 Length:558 Species:Drosophila melanogaster


Alignment Length:317 Identity:65/317 - (20%)
Similarity:135/317 - (42%) Gaps:47/317 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 DIIVTVHDRVFLCHNIILSIYSRRMLKI----LQEDVDHIVFKSNDLSPKGFSDAYLWMISSD-- 155
            |:.:.:..|.|...:|:.:.::|...||    ||..|..|     |::.  ....|.||::.:  
  Fly   206 DLEIQIESRFFFVSHILFTYFARNFRKISSQFLQMPVQKI-----DMAV--LIRIYEWMLNEEKT 263

  Fly   156 ---GEVNPCDMGEILRAAYFLDIPELLEACWANLDR---ITFFEISAFRLLFELRGATNLWDVFD 214
               |:    ::.....||::|.:.:|::..|:....   ...:||:||: .:.:.......::..
  Fly   264 FVVGQ----NLISFYAAAHWLGVHQLIKQAWSTFSADGVYDIWEINAFQ-AYIMAKDYRCPEIMI 323

  Fly   215 KLTGRISISILPVASTREFLCLSETQICYILKSNFLAINSEMEA---------SSISIRRSSTYR 270
            .:..|:....||:.::.|||.....::..:|:.:.|.:|||.|.         .|.:.|:....:
  Fly   324 VMQSRLRKCFLPIVASWEFLEFDVNEVTTLLEQDMLCVNSEDEIFFAVFHWLNYSWTERKKHAVK 388

  Fly   271 VLSQIRFSFLPPLMLKKFRSEELHKMPEFSDILKEFSKSPDVITLLRDSVFNSSLLLTV-----R 330
            |:.::||..|.|.:.:     .:..||| :|.:.|..:.|::.:|:.:.......::.:     |
  Fly   389 VMQKVRFGLLSPWLRR-----SICNMPE-NDRIGEIGQLPEICSLIWEGTLLCQAIIAIGQPEYR 447

  Fly   331 NNPSVLDTHVEFTEVELMEPRHWVQDHTCDYHRKVTQLCPNMRFITLNEYQEYLKRL 387
            .:..|.....:|....:.| |.||......:|.  .:.|...|.:|...::.:|.||
  Fly   448 RSRLVRRMLRDFEHKRITE-RSWVFCEGVPHHH--DKKCARYRELTFESFKRFLHRL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8260NP_573069.1 BTB 91..182 CDD:295341 20/93 (22%)
BTB 97..190 CDD:197585 21/104 (20%)
BACK 200..287 CDD:197943 19/95 (20%)
DUF4734 308..387 CDD:292506 14/83 (17%)
CG10801NP_570058.1 BACK 306..401 CDD:285009 20/95 (21%)
DUF4734 418..512 CDD:292506 16/87 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.