DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCT6 and Cct4

DIOPT Version :9

Sequence 1:NP_573066.1 Gene:CCT6 / 32518 FlyBaseID:FBgn0027329 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_877966.1 Gene:Cct4 / 29374 RGDID:727937 Length:539 Species:Rattus norvegicus


Alignment Length:520 Identity:162/520 - (31%)
Similarity:268/520 - (51%) Gaps:28/520 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RAAQALAINISAAKGLQDVMRTNLGPKGTVKMLVSGAGDIKITKDGNVLLHEMQIQHPTASMIAR 79
            :.||....||||||.:.|.:||:|||||..||:..|.||:.||.||..:|.:||:.||.|.|:..
  Rat    29 KPAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVE 93

  Fly    80 ASTAQDDSTGDGTTTTVMLIGELLKQADIYLSEGLHPRIMTDGFEKARDKALEVLDQVKVPVEI- 143
            .|.|||...|||||:.|::.|.||......|.:|:||.|:::.|:||.:|.||:|..:..||:: 
  Rat    94 LSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGLEILTDMSRPVQLS 158

  Fly   144 NKKNLVEVANTSLKTKVHPALADLLTDVCVNAVLTIASADKTKPVDLHMVELMEMQHKSDTDTQL 208
            :::.|:..|.|||.:||....:.||:.:.||||:.:........|||..:::::....:..|.:|
  Rat   159 DRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCEL 223

  Fly   209 VRGLVMDHGARHPDMPKRLENAYILTANVSLEYEKAEVNSGFFYKTAEEREAFVRAEREFIDQRV 273
            |.|||:.....:..: .|:|.|.|......|...|.::::........:.:..:|.||.:|...|
  Rat   224 VEGLVLTQKVANSGI-TRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLV 287

  Fly   274 KKVIELKRSVCDGTDKTFVLINQKGI-----DPISLDALAKEGILALRRAKRRNMERLSLACGGT 333
            |   ::|::.|:      ||:.||.|     ..::|..|.|..|:.::..:|.::|.:....|..
  Rat   288 K---QIKKTGCN------VLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTK 343

  Fly   334 AMNSFDDLQEEHLGYAGVVYEHVL-GENKYTFVEDCKNP-LSVTILIKGPNKHTITQIKDAIRDG 396
            .:...|....:.||.|.:..|..| |..|...:..|.:| .:|||:::|.||..|.:.:.:|.|.
  Rat   344 PVAHIDQFTPDMLGSAELAEEVSLNGSGKLFKITGCTSPGKTVTIVVRGSNKLVIEEAERSIHDA 408

  Fly   397 LRAINNTIADKALVPGAGAFEVRAYNELVAFKDTIKGKSRLAVQAFADALLVIPKTLAVNSGYDA 461
            |..|...:..:||:.|.||.|:.....|..:..|:.|.....|:|||||:.|||.|||.|:|.:.
  Rat   409 LCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNP 473

  Fly   462 QDTIVKLTVEDRLSPELVGLDLATGEPMKPVDLGVYDNYIVKKQILNSCSIIASNLLLVDEVMRA 526
            ..|:.:|........:..|:::..|        |:  :.|:::.::....:..|.|.|..|.:|:
  Rat   474 ISTVTELRNRHAQGEKTTGINVRKG--------GI--SNILEEMVVQPLLVSVSALTLATETVRS 528

  Fly   527  526
              Rat   529  528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCT6NP_573066.1 chap_CCT_zeta 3..532 CDD:274088 162/520 (31%)
TCP1_zeta 7..528 CDD:239458 162/520 (31%)
Cct4NP_877966.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
TCP1_delta 25..538 CDD:239454 162/520 (31%)
Cpn60_TCP1 44..539 CDD:278544 154/505 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D207515at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.